PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc01626.1.g00030.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family MYB
Protein Properties Length: 258aa    MW: 28461 Da    PI: 8.5862
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc01626.1.g00030.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding50.45.2e-161463148
                                  TSSS-HHHHHHHHHHHHHTTTT..-HHHHHHHHTTTS-HHHHHHHHHHHT CS
               Myb_DNA-binding  1 rgrWTteEdellvdavkqlGgg..tWktIartmgkgRtlkqcksrwqkyl 48
                                  rg+W++eEd +l  +++++Gg+  +W + +r+ g++R++k+c++rw++yl
  Zmw_sc01626.1.g00030.1.am.mk 14 RGPWSAEEDARLRSYIERHGGDggSWIALPRKAGLRRCGKSCRLRWLNYL 63
                                  89**********************************************97 PP

2Myb_DNA-binding43.95.5e-1470111245
                                   SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
               Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                                   g WT+eEd l+  + +  G++ W+ Ia++++ gRt++ +k++w+
  Zmw_sc01626.1.g00030.1.am.mk  70 GGWTPEEDRLICALYAAVGSR-WSIIAAHLP-GRTDNGVKNHWN 111
                                   67*******************.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129414.397963IPR017930Myb domain
SuperFamilySSF466896.6E-2712110IPR009057Homeodomain-like
SMARTSM007173.5E-101365IPR001005SANT/Myb domain
PfamPF002494.5E-141463IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.0E-221570IPR009057Homeodomain-like
CDDcd001675.34E-71663No hitNo description
PROSITE profilePS5129424.16564118IPR017930Myb domain
SMARTSM007175.5E-1268116IPR001005SANT/Myb domain
PfamPF002492.5E-1270111IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.0E-2371118IPR009057Homeodomain-like
CDDcd001673.33E-972111No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 258 aa     Download sequence    Send to blast
MGRSPCCDKA TVKRGPWSAE EDARLRSYIE RHGGDGGSWI ALPRKAGLRR CGKSCRLRWL  60
NYLRPDLRHG GWTPEEDRLI CALYAAVGSR WSIIAAHLPG RTDNGVKNHW NARLKKKIFA  120
AIMAPPPLQT RGSRRHGGSR YHHDAIVDAS TVPLLDPQPW SWSSQPDGTL TGCVGVGHKH  180
HVGAERETDT IAGKEPLCHT KPTDSSCSFG PALTELDEIV RSINANGGEH SHLSQSWGAD  240
IMEAPDWNQY QQGESVLL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A6e-27141187108B-MYB
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004964229.11e-81PREDICTED: transcription factor RAX1-like
TrEMBLA0A067FAN84e-66A0A067FAN8_CITSI; Uncharacterized protein
TrEMBLA0A0E0MPZ23e-66A0A0E0MPZ2_ORYPU; Uncharacterized protein
TrEMBLV4UEI64e-66V4UEI6_9R
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP13538412